A study of ziltivekimab compared to placebo in people with heart and blood vessel disease, chronic kidney disease and inflammation

3 1

What is this study about?

This study examines people with atherosclerotic cardiovascular disease, chronic kidney disease, and systemic inflammation. Atherosclerotic cardiovascular disease is a condition where fatty deposits build up in the arteries, which can affect blood flow to the heart, brain, or limbs. Chronic kidney disease means the kidneys are not working as well as they should, which affects their ability to filter waste from the blood. Systemic inflammation refers to widespread inflammation in the body that can be measured through blood tests. The study compares the effects of ziltivekimab, an experimental medication given as an injection under the skin once a month, with placebo. Both treatments are given in addition to the usual care that patients receive for their conditions.

The purpose of the study is to see if ziltivekimab works better than placebo in reducing the risk of serious heart-related problems in people who have both cardiovascular disease and kidney disease along with signs of inflammation in their body. The main focus is on preventing major cardiovascular events, which include death from heart-related causes, non-fatal heart attack, and non-fatal stroke. A heart attack occurs when blood flow to part of the heart muscle is blocked, while a stroke happens when blood flow to part of the brain is interrupted.

During the study, participants will receive either ziltivekimab or placebo through regular injections while continuing their standard medical treatment. The study will track various health outcomes over time, including heart attacks, strokes, heart-related deaths, hospital admissions for heart problems, and changes in kidney function. Researchers will also monitor changes in inflammation markers in the blood, heart function measurements, and overall health status. The study will measure how the kidneys are working by looking at blood test results that show the filtering ability of the kidneys and the amount of protein in the urine, which can indicate kidney damage.

1 Assignment to treatment group

Upon entering the study, you will be randomly assigned to receive either ziltivekimab or placebo. This assignment is done by chance, similar to flipping a coin.

The placebo looks identical to ziltivekimab but contains no active medication. This helps researchers determine if the study medication is effective.

Both ziltivekimab and placebo will be given in addition to your standard medical care, which means you will continue taking your regular medications as prescribed by your doctor.

2 Monthly injections

You will receive injections under the skin (subcutaneous injections) once every month throughout the study.

The medication is provided as a solution for injection, which means it is a liquid ready to be injected.

These monthly injections will continue for the entire duration of the study.

3 Regular monitoring visits

During the study, you will attend regular visits where various measurements and tests will be performed.

Blood samples will be taken to measure specific markers in your blood, including hs-CRP (a marker of inflammation in your body), NT-pro-BNP (a marker related to heart function), and haemoglobin (a component of blood that carries oxygen).

Your kidney function will be monitored by measuring eGFR (estimated glomerular filtration rate, which shows how well your kidneys are filtering waste from your blood) and UACR (urine albumin-to-creatinine ratio, which detects protein in your urine).

These measurements will be taken at the beginning of the study and repeated at specific time points, including at 2 years into the study.

4 Heart function assessment

Your heart function will be evaluated by measuring left ventricular ejection fraction, which indicates how well the main pumping chamber of your heart is working.

This measurement will be taken at the start of the study and again at 2 years.

5 Quality of life assessment

You will be asked to complete a questionnaire called Short Form 36, which assesses your physical health and how it affects your daily activities.

This questionnaire will be completed at the beginning of the study and at 2 years.

6 Ongoing health monitoring

Throughout the study, any health events will be recorded, including heart-related events such as heart attack (myocardial infarction), stroke, cardiovascular death (death related to heart or blood vessel problems), hospitalizations for heart failure, and procedures to restore blood flow to the heart or other arteries.

Kidney-related events will also be monitored, including significant decreases in kidney function or the need for kidney replacement therapy (such as dialysis or kidney transplant).

Any episodes of atrial fibrillation (irregular heart rhythm) will be documented.

Hospitalizations or deaths related to infections will be recorded.

All deaths from any cause will be tracked.

7 Continuation until study completion

You will continue receiving the monthly injections and attending monitoring visits until the study ends.

The study is expected to continue for several years, and the exact end date will be determined by the research team based on the number of health events observed across all participants.

Who Can Join the Study?

  • You must have chronic kidney disease, which means your kidneys do not work as well as they should. This can be shown in one of two ways: either your eGFR (a blood test that measures how well your kidneys filter waste) is between 15 and 60, or your UACR (a urine test that measures protein in your urine) is 200 or higher with an eGFR of 60 or above.
  • Your blood test must show a hs-CRP level of 2 or higher. This measures inflammation in your body, which means there is swelling or irritation inside your body that you may not be able to feel.
  • You must have atherosclerotic cardiovascular disease, which means you have hardening and narrowing of your blood vessels. This can be shown by having one or more of the following conditions:
  • You have coronary heart disease, which affects the blood vessels of your heart. This includes having had a heart attack in the past, having had a procedure to open blocked heart arteries, or having at least 50% blockage in a major heart artery shown by special imaging tests.
  • You have cerebrovascular disease, which affects the blood vessels in your brain and neck. This includes having had a stroke caused by blocked arteries, having had a procedure to open blocked neck arteries, or having at least 50% blockage in a neck artery shown by special imaging tests.
  • You have symptomatic peripheral artery disease, which affects the blood vessels in your legs and causes symptoms. This includes having leg pain when walking with an ankle-brachial index of 0.90 or less (a test comparing blood pressure in your ankle and arm), having leg pain with at least 50% blockage in leg arteries shown by special imaging tests, having had a procedure to open blocked leg arteries, or having had part of your leg amputated due to blocked arteries.
  • You must be an adult.
  • Both men and women can participate in this study.

Who Cannot Join the Study?

  • The study does not list specific reasons why patients cannot participate in the trial based on the available information
  • If you have questions about whether you can join this study, your doctor will need to review the complete study requirements with you
  • General factors that often prevent participation in clinical trials may include having certain other medical conditions, taking specific medications, or having recent surgeries, but these have not been specified for this particular study
  • Your healthcare provider will determine if you meet all the necessary requirements to safely participate in this research

Where you can join this trial?

Verified and Recommended Sites

No sites found in this category

Verified Sites

Other Sites

Site Name City Country Status
Diagnostic & Therapeutic Center Of Athens Hygeia Single Member S.A. Athens Greece
Ospedale San Raffaele S.r.l. Milan Italy
Karolinska University Hospital Solna Sweden
Sygehus Lillebaelt Vejle Sygehus Vejle Denmark
Spitalul Universitar De Urgenta Bucuresti Bucharest Romania
Amphia Hospital Breda The Netherlands
MVZ CCB Frankfurt Und Main-Taunus GbR Frankfurt Germany
Klinikum Coburg GmbH Coburg Germany
Spitalul Clinic Municipal De Urgenta Timisoara Timisoara Romania
Sal Med S.R.L. Pitesti Romania
Universitätsklinikum des Saarlandes – Homburg/Saar, Klinik für Urologie und Kinderurologie Homburg Germany
Vital s.r.o. Levice Slovakia
Az St-Jan Brugge-Oostende A.V. Brugge Belgium
Saarland University Hospital Homburg Germany
Hospital Universitario De Cruces Barakaldo Spain
Centrum Badan Klinicznych Piotr Napora Lekarze sp.p. Wroclaw Poland
University Multiprofile Hospital For Active Treatment St. Ivan Rilski EAD Sofia Bulgaria
Uniwersytecki Szpital Kliniczny W Poznaniu Poznan Poland
Klaipedos universiteto ligonine VšĮ Klaipeda Lithuania
Centre Hospitalier Regional De La Citadelle Liege Belgium
Instytut Centrum Zdrowia Matki Polki Lodz Poland
University Hospital St Marina Varna Varna Bulgaria
Gottsegen National Cardiovascular Center Budapest Hungary
Hospital Virgen De Las Montanas Villamartin Spain
ARNAS Civico Di Cristina Benfratelli Palermo Italy
Specijalna Bolnica Za Medicinsku Rehabilitaciju Krapinske Toplice Krapinske Toplice Croatia
Narodny Endokrinologicky A Diabetologicky Ustav Lubochna Slovakia
Cardioconsult s.r.o. Stare Mesto Slovakia
St. Josefskrankenhaus Heidelberg GmbH Heidelberg Germany
Azorg Aalst Belgium
Hjkgcceqjare Hmmenfiu Athens Greece
Gcinmxo Ulpyzgcxrm Hiiclpaw Od Llcvtvi Larissa Greece
Uyqjbtocnk Oa Dvswluhe Debrecen Hungary
Llaqr Gcrzxkt Hbfvbpmv Ok Airxpv Athens Greece
Uaodksagcy Gbdcxqp Hswjclwn Oj Tczjkqnzovxv Aajrn Thessaloniki Greece
Mfqdjhe Ciejcd Havl Efsh Sofia Bulgaria
Uzjqnadbif Grjgiuw Hpgkzubz Os Ilwomjmh Ioannina Greece
Dclpcsdjrdlkdspmjhbsahx crlyzi “lwdutyyxkcnaayi Eium Sofia Bulgaria
Rkiald Sbllxiqnl Holbæk Denmark
Oaoolm Uizsnlpoqm Htjfelyi Odense Denmark
Fcqezycmco Iuxdx Pteqblmdzae Sgu Mjzxpc Pavia Italy
Rpjesi Sswbw Spzejp Uqdhdlbjvijgtbpodys Lund Sweden
Uazlltbybiixncynh Dypcn Sttgu Db Vbuzxc Verona Italy
Avhhjhdsj Hpligoib Athens Greece
Ulzdwtm Unkrogimai Hfxsyuqc Uppsala Sweden
Crgvhbe Udzjdkulbstxpjrluqdp Bqlamq Kyq Berlin Germany
Idtys Ogvbywku Phxllufncof Srh Mvkgzal Genoa Italy
Umljpdgzma Ccbnfeun Hjuffgyf Vzefqg Dq Lr Aaqcigbm Murcia Spain
Cnabyr Hvzbvsakes E Uwxlmgmkdlzji Dx Cbtunfr Eqrcol Coimbra Portugal
Akqqhpa Uofdtuplen Htusvsnj Aalborg Denmark
Ambbgqv Ovczqiobyll Urrkhmbspdmsb Fcjbioca Im Do Nymhnc Naples Italy
Ggzkcmb Ujxdjymujb Hnuhrqkc On Pxjgsa Patras Greece
Ihvpjyyw Uir Kaunas Lithuania
Mnyhchb Cmrgfc &jcjgao Ucahtwchsi Ok Frrlwjix Freiburg Im Breisgau Germany
Aiufym Mvxrite Cgmicp Sjkb Thessaloniki Greece
Uwahqmdycz Gdqrixn Hohbjcof Ov Amxfncdhhvzlnx Alexandroupoli Greece
Rrrida Mjvqxjplmmt Aarhus Denmark
Ubyycmxeef Op Sncgln Szeged Hungary
Acqflrc Ugbry Svwghoouu Lqfybv De Bshsfgg Bologna Italy
Pzqclmmndst Sfwxmc dpuhox Zagreb Croatia
Abhckhu Ooudlskekvj Pwch Gtytrbrr Xqifa Bergamo Italy
Rofecc Odyjpzs Loru Orebro Sweden
Iucbcejjk Fwq Cipffgfb Axs Eluatmimttas Mlkrwmbk Prague Czechia
Aevszysu Zrsbrdnzds Kgygd Brasschaat Belgium
Ujmdsimnfpxvpvwhfvcjz Avwoqt Aht Aachen Germany
Upyjjbictswwbufbjfozi Sroqrnubknocbydioq Afx Kiel Germany
Hruacgwm Uojnjkykrluwx Pqjcsu Dj Heoaoe Dx Myhsjipvrsj Majadahonda Spain
Umhnnkrlsk Dygyi Sxxbv Dr Bljpxgl Brescia Italy
Ubfmwubudqisgsetr Dhqwx Saysw De Fzswrtm Ferrara Italy
Qposd Snkumb Cmoftadbr Hlfbmijm &iodkbl Stgvwcuxfqf Uvawkcabhx Hrfjgbdn &szgijp Vunqdmd Gqiaksokpfslsnirzf Gothenburg Sweden
Cafovof Mqblylg Dn Dvjoqgnata Sx Tyxxsrjap Anavxfowl Novxzm Svuqzf Brasov Romania
Gbllyb Nfdjzypktm Tksqcknphivop Glfwhn Ppnfdztrbhfr Thessaloniki Greece
Aodqboqx Zozolpjxdh Gmtfpdfun Kortrijk Belgium
Ccsk Cpsoov Cgtlvnh Aebudotpw Bobka Aqcoilicjw Braga Portugal
Tymvor Cvebhv Smtf Thessaloniki Greece
Ugqqlyoqhk Gmfaizn Hyiwvixj Od Hgyenvrgw Heraklion Greece
Cujurr Hhzedevqzf Dn Tfwwie E Sqoka Eoztmm Guilhufe Portugal
Mafloui ghrav Koykzr svdxcd Kosice Slovakia
Esfxjf sltqay Nachod Czechia
Kknywtf Hdtni &nylb Hhrvn Az Lund Sweden
Mralanh Cuieta Mfwyvbbsyw Pzhdow Ops Pleven Bulgaria
Uqmehuvuvt Gpmndnn Hpyxtqdy Aekaemy Gynzvbk Hofocryn Oc Wbdy Aluvqv H Azze Vsvwygj Chaidari Greece
Aacjmsg Oppyxlkqpoa Ukmphxzxjillx Pdmecg Pisa Italy
Prumm Slljyrak Cotjjlpi Umkggoianb Hhvrutjb Riga Latvia
Ufdadznxpa Mffnjfgjoauq Hlwettit Fmt Ahbuke Turoakwzl Slxzj Gpngzf Ela Plovdiv Bulgaria
Hlnfozcd Mnzfzdt Sacunbln Snisqq Bucharest Romania
Cufaqrqfad Sfptsz Iasi Romania
Kwb Zluwlv Zagreb Croatia
Sfhvutiorirdovt Gethapf Dfeftddixqprxph Rdmymexs Rsrnvsbgnhh Gorzów Wielkopolski Poland
Sdtxlmgy Ctjzqv Jthzpzji Dk Uuwlrfs Blmmf Oradea Romania
Udsqlbkxds diyfg skjzh Gvzmwdkr Dvvivkigan Clwuqcboyglaji Cravup dq Szoto e twyvyajifx aoldmgox Chieti Italy
Nhyeotu ubolh sxjgthmcm a cutfbxma csbakx ahro Bratislava Slovakia
Clr Ddm Pdljnqxnh Ctxezetm Targu Mures Romania
Iwtzmyttoi do Bqqy Caxkwkdyfjjnssb &qisucysotdo Dag Gkqhuo Iynj Gvqcdvwxwfiqbazg Inmc Iasi Romania
Myus Ngreimvr Hmeee Hbxvhhsh Euq Sofia Bulgaria
Udcxjcxpzwvnp Srznows Kjdogetam W Bgtycjponhp Bialystok Poland
Dlfcrm Cmpijwiu Rxrfsjxi Dzzvvuzuifc Gsow Duesseldorf Germany
Mikkkak Cwwvow Bbbmtjds Lnbr Yambol Bulgaria
Zovqkxjk dklgior czztkz Sni Jelgava Latvia
Nldaoapql Slmgh Slany Czechia
Pcejlmb Mkgnvf Sqt z Ohtv Exb Plsurmvki Poniatowa Poland
Swx Kykvmnop Kddycsydfxjsmqmjqgpzdmnl Gska Karlsbad Germany
Mxn Chry Bsvicmzrw Srouyu Buzau Romania
Psqyektkk 2icm Mcrad Stara Zagora Bulgaria
Krlqcg Lftx Gdansk Poland
Igvfxe sjjoli Presov Slovakia
Ktsrlrq Swo z oo oc Ostrow Mazowiecka Poland
Slpptf swxoph mbgpyxwqs cxjheex Ugn Kaunas Lithuania
Kyyaewhisxd Ssdlvmskqf Ubn Kaunas Lithuania
Gfgykpm Hdzjuapn Oz Thpisufviynt Amgpe Pvvmsx Kalamaria Greece
Itidaislo schazg Nitra Slovakia
Cbfjxepnnbpkx Cem Grqm Frankfurt Germany
Cuuhmrh Mnbbcsl Ixqlrmilkt dt Cxjrhsdhdke Doz Poc Czkbc Baia Mare Romania
Ztggjqo Seqx Axebujysl i Ddzzhy Daaphx Wroclaw Poland
Scxfddffqeazwik Pjnksrlm Lfvekyrf Eet Mmzddnzdiluvldvm Cracow Poland
Mvakewl Cdipqp Ijyb Tmefcqit Yjfhgx Exgs Sofia Bulgaria
Kqjaaudl bphswttt conwhi Rldszu (yxamklvr Hvhqgzxk Ctrrsm Rztbnbk Rijeka Croatia
Dpnjlazkvs Cxokqnmzzypb Cwkxma (oabd &ftuoegfoweg Aspshhtnild Eskv Sofia Bulgaria
Esrjocpsfgujj Boz Baja Hungary
Zfohcji fix koesxhtot Fwjhdxxfud Dki mzli Lhoxxvun Falkensee Germany
Axo Mrk Lzrb Daugavpils Latvia
Drmmv Mkeyigs Spkroo Bucharest Romania
Czzeogg Mdufdxh Etfjvvg Bqvvbfqey Bucharest Romania
Nvvnywxxx Mheegln Snxtb Craiova Romania
Mnbvkcf Cgnjnq Mfpw Ctnk Olq Kyustendil Bulgaria
Sxklmwt Pkcyaxjxa ijj Hizpwxsk Svpgmmoucx Lxqykmxhmluh Sxhhikgzrir Pm Zvrcof Oxjaxi Zxhnnudxl Węgrów Poland
Pcpgdqax Lqybxefa Mkefsrj Srwqk Cracow Poland
Cvglfze Metgynht Vxgy Pqmjmoqq Knzyouoovbzffi Szczecin Poland
Sltxcjjyksadapu Pxgnding Lxgajhyj w Ojkbkwghcjt Ogrodzieniec Poland
Pvwwlv Reqphdkmgrnl Reichelsheim Germany
Aixbgit Ogzppznkydu Pfw Lpkoarxbxwjqscpaf Ctnnwnhwce Catania Italy
Afhkdb Ubzlmghvgc Hnaoknjm Aarhus Denmark
Rfyvm Alpsnzpz kywimgpf uupeyfirqmchc sntcfezj Syp Riga Latvia
Semxnnoq Cirfnq Jzkcxpos Dl Ucnrzkn Sjwdzbg Ahlliky Azztmn Cqqjjajdx Constanta Romania
Aawfhuyrn Utx Amsterdam The Netherlands
Bsifhiawr Ehqbbgpqzso Kbae Zalaegerszeg Hungary
Chmcvhsknhqp Kfcz Balatonfured Hungary
Kryyns Chvgly Ksqqgssqz Spl z ookd Zamosc Poland
Zhfzt Mdyaeiq Cjnzahq Smkdgimpe Zaandam The Netherlands
Gnhegs Umoosrzrfu Frirdyxdf Frankfurt Germany
Chncvw Hoetestwmt Du Bdclf Veqna Ekhvxu (knra Exlafbt Aveiro Portugal
Bqsgdc Zgxpvvlqrn Roosendaal The Netherlands
Cqdgjg Hpvvagqpdo df Stuwnfq Egbdjr Setubal Portugal
Ajkavyea Hlmkn Ox Puoayx Snpw Kedzierzyn-Kozle Poland
Akxvxff Ceicxkf Sao z opxs Satc Ruda Slaska Poland
Pqjkjdh Vgfzwa Uqi Siauliai Lithuania
Kczxpiwpr Na sgidml Nove Zamky Slovakia
Jytu Fnvkdp Dzazvtfmf Kwjdqd Ec Rsdvyvimtgtmte Budapest Hungary
Sluqliet Cykjyd Dg Umdkroe Sfcyxec Bucharest Romania
Zqjlockpdp Ojwb Lfucfvt Genk Belgium
Gqsjr Hidagizey Zutphen The Netherlands
Srmov Mlkifn Scb z oxgx Sgce Lodz Poland
Ndwavkkpe Ztpielbygbktapa Sptjdtusa Alkmaar The Netherlands
Cwofeh Cuogogsjmmop Mgxkpbk Sosboj Milan Italy
Axskhor Owbiwkqdeieqkomtkieglrqqz Sdkf Ammyq Rome Italy
Ahmz Aplqjobxqz Pvnzmzsiou Den Dzusswanmw Dp Pnsgizzk Lisbon Portugal
Hlllokzl Hacpbpsk Hvidovre Denmark
Mhmamgyhsmbydsdbdsbrizuzyp Hjaqrwbsatmbwlky Halle (Saale) Germany
Egjhl Ukvnqmgqav Esxggtiye Hiajqkny Bucharest Romania
Ucolmbl Lvkuu Dk Srnhx Da Gngjsvcipgoz Eoglhy Vila Nova De Gaia Portugal
Nfoywsuz Incmrpzk Kvrlnoclqey Syslrdy Koieyzbqp Wtuhfcjljqrn Pkobypmhc Iexqloia Biabpmxg Warsaw Poland
Axhoyny Oawcgiisolt Udgzaginzuyxk Pyvoxlmyyod Pxwob Ggiwarwd Palermo Italy
Uudomtgshh Hwbldpjb Bpbsweasuv Bratislava Slovakia
Ujjfzcvjdh Mrppf Gususrk Og Cgoyujpyb Catanzaro Italy
Ticzqsggzmrlcalrqvc Hilversum The Netherlands
Lmzjuvoi svgbvoexq mxomsp uplzhqusiakx lljmfqkh Kkhhr kwrviyfh Kaunas Lithuania
Avokps Sgy Riga Latvia
Aihsskr Ujuba Lrrqsu Sifly Selbuxjgh N 8 Bsrwbq Vicenza Italy
Igadmo Bonheiden Belgium
Imqrdsrc Fjiooltyc Gsbh Essen Germany
Rbyypn Ijrixzel fxyw muxbxbkfdubl Szaujld usj Fdkmxsvxxis Gekt Oldenburg In Holstein Germany
Ewucxmm Mechelen Belgium
Kqnnkxwe Sbine Jwplq Kfkaru Komarom Hungary
Swkidposfef Pnsqkftwy Ssqkuujuudfzhoa Sblhpmq Zzknsmyg Ixsxfmstfd Pgeri It Grodzisk Mazowiecki Poland
Huhyjhai Uqolvgdklbtmo Dt Pclnz Accdzbiunu Valencia Spain
Alorwzsw Zienzoxvra Dwhigzo Ovrwacjl Ostend Belgium
Cnkfyk Mss Swgelk Craiova Romania
Dyjloa Oqgojdm Sfzskk Galati Romania
Icqmouubqq Ds Bpgz Cqdwdrcjikeoxpq Tyxwqqazy Timisoara Romania
Dpbfwxebgl rqcsygvyt sixpbygl Sdu Daugavpils Latvia
Uhckwxd Lqauy Do Spnai Do Anev Mtlng Eaazkb Ponte De Lima Portugal
Mfezernr Ciwiuvb Deqwylkcrhcqweyzhvtyicadclwwwplhhdrlmdfwtcqivg Dwolnxrumohwr Sse z oaiz Cracow Poland
D &ewoc A Rwlwmwni Bwex Sneek The Netherlands
Zufacparifprlwj Tdfmfz Sszbyxhod Almelo The Netherlands
Abjxxslw Cxiu Clcynh Uhzmhvhrqh Mdovhjekijpp Hzqeljmn Fge Agdazm Tkxccsqws Eptz Sofia Bulgaria
Hxzpnakc Vkehjl Drc Cgfscz Sanlucar De Barrameda Spain
Zaplxfowtr Su Japajgf Harderwijk The Netherlands
Ukoxtnp Leuvo Dm Sidhq Di Mxkrzvsehz Ezhunx Senhora Da Hora Portugal
Slxsgjge Jdrpekce Dg Uuarvek Bvvjvf Braila Romania
Мzdyzzanhzkvjdxlw hfegqllw foh abbldt tydzelprq Sajgk Gygsal Pyddaq Opv Pernik Bulgaria
Ibshug Zsfhhfkqoj Rotterdam The Netherlands
Ussgbkyvvxhpn Skusavm Keaquuifz Nu 2 Uhsenetarvib Mniwhdqewj W Ltfwz Suiqn Lodz Poland
Kafrfd cjsq pryalgnjal Pljpqy ithaqtzttqa Kaunas Lithuania
Mwthismxryqfs Harokbqc fci Aeglum Timnhsave Hyahe axp Bxmbs Euz Pleven Bulgaria
Pzeiepgpye Kson Bekescsaba Hungary
Elsnaymqv Ifslwunvv Fpn Cqfgdahwketnaw Dbpahlba Aqo Tffkdgdguw Targu Mures Romania
Dltbcpf szaqdp Bratislava Slovakia
Fxsdomyoeifesgy Dfwmuekewklluuzj Bwvguxmqygbpjxcixzwt myl Dresden Germany
Dyjbbx Cqzluxqog Sefayc Bucharest Romania
Glliybq Hzwdsuaq Ol Cpeur Skajwhdscf Chios Greece
Bmujp Pfqxgv Sdelpl Pascani Romania
Gzitell Hwvaawyq Of Nho Icvpb Kfplzlrolkjdtbcm Pindpkfa Nea Ionia Greece
Lefwy Mrk Sxqjxz Bucharest Romania
Rwirfbocbmli Pwuzrokpe lqokqhdz Vmj Panevezys Lithuania
Mrjkapb ajax Prague Czechia
Djoxtnpgxb Mykpmru Cbizlv 2sdj Lfcl Dimitrovgrad Bulgaria
Mlevlva Cxkhgq Nsq Rhfztfrkwtchxh Czrlot Exeo Stara Zagora Bulgaria
Muebaqyehx Kkojanah Midpu Gbxx Mainz Germany
Ixbojvfcrllb Sxhhigfnmvbcebx Psjtbxhe Loosisve w dpnevjrqwl krxniugvttx Lxw mrvo Kpuqcjaku Cuqrtnfy Gdynia Poland
Cjtswcmi Hxfapqbd Dqescov Zagreb Croatia
Ccgfzklaq Sps z okkb Lublin Poland
Fculkcrd Nappkenzv S Pkkcicdxjggs Jr Aa Rlxeycz Pomvkj Presov Slovakia
Knhhhimxk Snvwjcy Sijimibwewgleax iu Jxhj Pmqbp Ip Cracow Poland
Asdxzow Sinlnmckq Unsrtqehtdnaa Gpqjteah Iduimwgz Trieste Italy
Caxhitf Khhrskbiuxqlifxklx Jojcotccoel Bkmrazjabrapgzbzfumozbmv Lekgmqz sjnpy Elblag Poland
Mblqrsc Kz stnyex Piestany Slovakia
Ziebwgx fnh kcstrcmge Sfekoag Sopbvqvccalyod Gznb Elsterwerda Germany

Want to learn more about this study or check if you can participate? Contact us.

Trial status

Country Status Recruitment Start
Belgium Belgium
Not recruiting
01.09.2021
Bulgaria Bulgaria
Not recruiting
01.09.2021
Croatia Croatia
Not recruiting
01.09.2021
Czechia Czechia
Not recruiting
01.09.2021
Denmark Denmark
Not recruiting
01.09.2021
Germany Germany
Not recruiting
01.09.2021
Greece Greece
Not recruiting
01.09.2021
Hungary Hungary
Not recruiting
01.09.2021
Italy Italy
Not recruiting
01.09.2021
Latvia Latvia
Not recruiting
01.09.2021
Lithuania Lithuania
Not recruiting
01.09.2021
Poland Poland
Not recruiting
01.09.2021
Portugal Portugal
Not recruiting
01.09.2021
Romania Romania
Not recruiting
01.09.2021
Slovakia Slovakia
Not recruiting
01.09.2021
Spain Spain
Not recruiting
01.09.2021
Sweden Sweden
Not recruiting
01.09.2021
The Netherlands The Netherlands
Not recruiting
01.09.2021

Trial locations

Investigated Drugs:

Ziltivekimab is an investigational medication given as an injection under the skin once a month. It is being tested to see if it can reduce the risk of major heart problems in people who have heart disease, kidney disease, and inflammation in their body. This medication is given in addition to the standard treatments that patients are already receiving for their conditions.

Placebo is an inactive substance that looks like the real medication but contains no active medicine. It is used in this study to compare against ziltivekimab to help determine if the real medication is working. Patients receiving placebo will also continue to receive their standard care treatments.

Atherosclerotic Cardiovascular Disease – Atherosclerotic cardiovascular disease is a condition where fatty deposits called plaques build up inside the arteries that supply blood to the heart and other parts of the body. These plaques are made up of cholesterol, fat, calcium, and other substances found in the blood. Over time, the plaques harden and narrow the arteries, reducing blood flow to vital organs. As the disease progresses, the plaques can rupture or break open, leading to blood clot formation. This reduced blood flow can cause chest pain, shortness of breath, and may lead to serious events such as heart attacks or strokes. The condition develops gradually over many years and often shows no symptoms in its early stages.

Chronic Kidney Disease – Chronic kidney disease is a long-term condition where the kidneys gradually lose their ability to filter waste products and excess fluids from the blood. The kidneys become damaged over time due to various factors such as high blood pressure, diabetes, or other underlying health conditions. As the disease progresses, waste products and fluids build up in the body, which can cause various health problems. The kidney function is measured by a value called estimated glomerular filtration rate, which decreases as the disease worsens. In advanced stages, the kidneys may lose most of their filtering ability, requiring medical intervention to remove waste from the blood. The progression of the disease is typically divided into five stages, with stage five being the most severe.

Systemic Inflammation – Systemic inflammation is a condition where the body’s immune system remains activated throughout the entire body rather than just in a specific area. This widespread immune response causes the release of inflammatory substances into the bloodstream that affect multiple organs and tissues. The inflammation persists over time and can be measured through blood tests that detect markers such as C-reactive protein. This ongoing inflammatory state can contribute to damage of blood vessels and organs throughout the body. The condition often occurs alongside other diseases and can worsen their progression. Unlike acute inflammation that resolves quickly, systemic inflammation continues for extended periods and becomes a chronic health issue.

Trial ID:
2023-506926-35-00
Protocol code:
EX6018-4758
Trial Phase:
Therapeutic confirmatory (Phase III)

Other Trials to Consider

  • Effect of Lepodisiran on Coronary Plaque in Adults with Elevated Lipoprotein(a) and Established Atherosclerotic Cardiovascular Disease or High Risk for First Event

    Recruiting

    3 1
    Investigated Diseases:
    Investigated Drugs:
    Czechia Hungary The Netherlands Spain
  • A study to compare the effects of BI 690517 and spironolactone on kidney function in patients with heart failure, cardiovascular disease, or chronic kidney disease

    Recruiting

    2 1 1 1
    The Netherlands